Recombinant Full Length Human Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged
Cat.No. : | RFL34907HF |
Product Overview : | Recombinant Full Length Human Cytochrome b-245 heavy chain(CYBB) Protein (P04839) (2-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-570) |
Form : | Lyophilized powder |
AA Sequence : | GNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLN FNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLF NVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVV ITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHNI TVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVV THPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDW TEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILK SVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLT GWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEA LAETLSKQSISNSESGPRGVHFIFNKENF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYBB |
Synonyms | AMCBX2; CGD; CGD91-phox; CY24B_HUMAN; CYBB; Cytochrome b 245; beta polypeptide; Cytochrome b(558) beta chain; Cytochrome b(558) subunit beta; Cytochrome b-245 heavy chain; Cytochrome b558 subunit beta; GP91 PHOX; gp91-1; gp91-phox; GP91PHOX; Heme-binding |
UniProt ID | P04839 |
◆ Recombinant Proteins | ||
CYBB-2781H | Recombinant Human CYBB protein, His-tagged | +Inquiry |
CYBB-2222H | Recombinant Human CYBB Protein, GST-tagged | +Inquiry |
RFL17396BF | Recombinant Full Length Bison Bison Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged | +Inquiry |
CYBB-443H | Recombinant Human CYBB Protein (283-570 aa), His-SUMO-tagged | +Inquiry |
CYBB-3727C | Recombinant Chicken CYBB | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYBB-7138HCL | Recombinant Human CYBB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYBB Products
Required fields are marked with *
My Review for All CYBB Products
Required fields are marked with *
0
Inquiry Basket