Recombinant Full Length Human CXCL6 Protein, GST-tagged

• Cat.No.: CXCL6-2299HF
• Product Overview: Human CXCL6 full-length ORF ( AAH13744, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CXCL6 (C-X-C Motif Chemokine Ligand 6) is a Protein Coding gene. Diseases associated with CXCL6 include Mastitis and Rheumatoid Arthritis. Among its related pathways arePeptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include heparin binding andCXCR chemokine receptor binding. An important paralog of this gene is CXCL5.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 38.28 kDa
• Protein length: 114 amino acids
• AA Sequence: MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXCL6 chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) [ Homo sapiens ]
• Official Symbol: CXCL6
• Synonyms: CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2; chemokine alpha 3; small-inducible cytokine B6; granulocyte chemotactic protein 2; Small inducible cytokine subfamily B (Cys-X-Cys), member b; small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2); GCP2; CKA-3; GCP-2; SCYB6
• Gene ID: 6372
• mRNA Refseq: NM_002993
• Protein Refseq: NP_002984
• MIM: 138965
• UniProt ID: P80162