Recombinant Full Length Human CXCL14 Protein, GST-tagged

• Cat.No.: CXCL14-2285HF
• Product Overview: Human CXCL14 full-length ORF ( AAH03513, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq, Sep 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 37.95 kDa
• Protein length: 111 amino acids
• AA Sequence: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXCL14 chemokine (C-X-C motif) ligand 14 [ Homo sapiens ]
• Official Symbol: CXCL14
• Synonyms: CXCL14; chemokine (C-X-C motif) ligand 14; SCYB14, small inducible cytokine subfamily B (Cys X Cys), member 14 (BRAK); C-X-C motif chemokine 14; BMAC; bolekine; BRAK; breast and kidney; Kec; KS1; MIP 2g; NJAC; MIP-2 gamma; chemokine BRAK; tumor-suppressing chemokine; small-inducible cytokine B14; CXC chemokine in breast and kidney; small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK); KEC; MIP2G; MIP-2g; SCYB14; MGC10687
• Gene ID: 9547
• mRNA Refseq: NM_004887
• Protein Refseq: NP_004878
• MIM: 604186
• UniProt ID: O95715