Recombinant Full Length Human CTNNA1 Protein, GST-tagged

• Cat.No.: CTNNA1-2294HF
• Product Overview: Human CTNNA1 full-length ORF ( AAH31262.1, 1 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the catenin family of proteins that play an important role in cell adhesion process by connecting cadherins located on the plasma membrane to the actin filaments inside the cell. The encoded mechanosensing protein contains three vinculin homology domains and undergoes conformational changes in response to cytoskeletal tension, resulting in the reconfiguration of cadherin-actin filament connections. Certain mutations in this gene cause butterfly-shaped pigment dystrophy. [provided by RefSeq, May 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 85.9 kDa
• Protein length: 536 amino acids
• AA Sequence: MTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTNNA1 catenin (cadherin-associated protein), alpha 1, 102kDa [ Homo sapiens ]
• Official Symbol: CTNNA1
• Synonyms: CTNNA1; catenin (cadherin-associated protein), alpha 1, 102kDa; catenin (cadherin associated protein), alpha 1 (102kD); catenin alpha-1; CAP102; alpha-catenin; alphaE-catenin; alpha E-catenin; alpha-E-catenin; renal carcinoma antigen NY-REN-13; cadherin-associated protein,102kDa; FLJ36832; FLJ52416
• Gene ID: 1495
• mRNA Refseq: NM_001903
• Protein Refseq: NP_001894
• MIM: 116805
• UniProt ID: P35221