Recombinant Full Length Human CTBS Protein, GST-tagged

Cat.No. : CTBS-2209HF
Product Overview : Human CTBS full-length ORF ( AAH24007.2, 37 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 105 amino acids
Description : Chitobiase is a lysosomal glycosidase involved in degradation of asparagine-linked oligosaccharides on glycoproteins (Aronson and Kuranda, 1989 [PubMed 2531691]).[supplied by OMIM, Nov 2010]
Molecular Mass : 33.22 kDa
AA Sequence : DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTBS chitobiase, di-N-acetyl- [ Homo sapiens ]
Official Symbol CTBS
Synonyms CTBS; chitobiase, di-N-acetyl-; CTB; di-N-acetylchitobiase
Gene ID 1486
mRNA Refseq NM_004388
Protein Refseq NP_004379
MIM 600873
UniProt ID Q01459

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CTBS Products

Required fields are marked with *

My Review for All CTBS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon