Recombinant Full Length Human CRTC1 Protein, C-Flag-tagged
Cat.No. : | CRTC1-1443HFL |
Product Overview : | Recombinant Full Length Human CRTC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables cAMP response element binding protein binding activity. Involved in positive regulation of transcription by RNA polymerase II. Located in cytosol; nuclear body; and plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.1 kDa |
AA Sequence : | MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQ IGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSP PADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTG SRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGN LAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPALSPLSPITQAVAMDALSLEQQL PYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS LPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYE QQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPN IILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFR MDRLSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | CRTC1 CREB regulated transcription coactivator 1 [ Homo sapiens (human) ] |
Official Symbol | CRTC1 |
Synonyms | MAML2; MECT1; Mam-2; TORC1; TORC-1; WAMTP1 |
Gene ID | 23373 |
mRNA Refseq | NM_015321.3 |
Protein Refseq | NP_056136.2 |
MIM | 607536 |
UniProt ID | Q6UUV9 |
◆ Recombinant Proteins | ||
FXYD5-2424R | Recombinant Rat FXYD5 Protein | +Inquiry |
KLRD1 & KLRC1-321H | Recombinant Human KLRC1&KLRD1 protein, mFc-tagged | +Inquiry |
GZMB-3248H | Recombinant Human GZMB Protein (Ile21-Arg246), N-His tagged | +Inquiry |
NI36-RS11180-0874S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS11180 protein, His-tagged | +Inquiry |
COTS-0597B | Recombinant Bacillus subtilis COTS protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F10-5392M | Active Native Mouse Coagulation Factor X | +Inquiry |
GHRH-37H | Active Native Human GHRH | +Inquiry |
TSH-25H | Active Native Human Thyroid Stimulating Hormone protein | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
Pepsin-41P | Active Native Porcine Pepsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
L3MBTL2-373HCL | Recombinant Human L3MBTL2 lysate | +Inquiry |
TIAM2-1780HCL | Recombinant Human TIAM2 cell lysate | +Inquiry |
SNX6-1586HCL | Recombinant Human SNX6 293 Cell Lysate | +Inquiry |
KRT34-4870HCL | Recombinant Human KRT34 293 Cell Lysate | +Inquiry |
Cecum-487C | Chicken Cecum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CRTC1 Products
Required fields are marked with *
My Review for All CRTC1 Products
Required fields are marked with *
0
Inquiry Basket