Recombinant Full Length Human CRIP2 Protein, GST-tagged

• Cat.No.: CRIP2-2056HF
• Product Overview: Human CRIP2 full-length ORF ( NP_001303, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.51 kDa
• Protein length: 208 amino acids
• AA Sequence: MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRIP2 cysteine-rich protein 2 [ Homo sapiens ]
• Official Symbol: CRIP2
• Synonyms: CRIP2; cysteine-rich protein 2; CRP2; ESP1; CRP-2; Cystein-rich intestinal protein; CRIP
• Gene ID: 1397
• mRNA Refseq: NM_001312
• Protein Refseq: NP_001303
• MIM: 601183
• UniProt ID: P52943