Recombinant Full Length Human CRELD2 Protein, C-Flag-tagged

• Cat.No.: CRELD2-709HFL
• Product Overview: Recombinant Full Length Human CRELD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable calcium ion binding activity and protein disulfide isomerase activity. Predicted to be located in Golgi apparatus; endoplasmic reticulum; and extracellular space.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 38 kDa
• AA Sequence: MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYES SEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLAC QGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLT NRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISG YAREHGQCADVDECALAEKTCVRKNENCYNTPGSYVCVCPDGFEGTEDACVPPAEAEATEGESPTQLPSR
  EDLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Full Length: Full L.

Gene Information

• Gene Name: CRELD2 cysteine rich with EGF like domains 2 [ Homo sapiens (human) ]
• Official Symbol: CRELD2
• Synonyms: DKFZp667O055; MGC11256
• Gene ID: 79174
• mRNA Refseq: NM_024324.5
• Protein Refseq: NP_077300.3
• MIM: 607171
• UniProt ID: Q6UXH1