Recombinant Full Length Human CRB3 Protein, GST-tagged

• Cat.No.: CRB3-2259HF
• Product Overview: Human CRB3 full-length ORF ( NP_631900.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 120 amino acids
• Description: This gene encodes a member of the Crumbs family of proteins. This gene is widely expressed in epithelial tissues where the encoded protein isoforms play various roles such as the control of cytokinesis and ciliogenesis or the formation of tight junctions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]
• Molecular Mass: 39.3 kDa
• AA Sequence: MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRB3 crumbs homolog 3 (Drosophila) [ Homo sapiens ]
• Official Symbol: CRB3
• Synonyms: CRB3; crumbs homolog 3 (Drosophila); crumbs protein homolog 3; MGC17303
• Gene ID: 92359
• mRNA Refseq: NM_139161
• Protein Refseq: NP_631900
• MIM: 609737
• UniProt ID: Q9BUF7