Recombinant Full Length Human CPTP Protein, GST-tagged

• Cat.No.: CPTP-5356HF
• Product Overview: Human GLTPD1 full-length ORF ( AAH04366.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 221 amino acids
• Description: CPTP (Ceramide-1-Phosphate Transfer Protein) is a Protein Coding gene. Among its related pathways are Metabolism and Sphingolipid metabolism. GO annotations related to this gene include phospholipid binding and glycolipid binding. An important paralog of this gene is GLTPD2.
• Molecular Mass: 49.4 kDa
• AA Sequence: MCPHLRPVPGTPCLPRWAALSPGDSVPSMPWLAETLNSSLGTVGLSPPLLPCLPLSVPGRLGAGQPEAETKAPHRRAQEVPALGTASSVAPARHQFPEGRSRPPPAAAVGLHSPAQPKAPRSWDSATPSEMLCPFSPVPLDAPSPQCSGDPWGTEQEGLDPVAQPKATRQPQPAQPPSSAWGLATGSSQWTPAPRGGRGTAPTAQQTCELPECNLCDVFQR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CPTP ceramide-1-phosphate transfer protein [ Homo sapiens (human) ]
• Official Symbol: CPTP
• Synonyms: CPTP; ceramide-1-phosphate transfer protein; GLTPD1; ceramide-1-phosphate transfer protein; GLTP domain-containing protein 1; glycolipid transfer protein domain containing 1; glycolipid transfer protein domain-containing protein 1
• Gene ID: 80772
• mRNA Refseq: NM_001029885
• Protein Refseq: NP_001025056
• MIM: 615467
• UniProt ID: Q5TA50