Recombinant Full Length Human CPQ Protein, C-Flag-tagged
Cat.No. : | CPQ-1422HFL |
Product Overview : | Recombinant Full Length Human CPQ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALL VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIG TPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASF SIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKY PEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLH KVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGA SLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Protease |
Full Length : | Full L. |
Gene Name | CPQ carboxypeptidase Q [ Homo sapiens (human) ] |
Official Symbol | CPQ |
Synonyms | LDP; PGCP |
Gene ID | 10404 |
mRNA Refseq | NM_016134.4 |
Protein Refseq | NP_057218.1 |
MIM | 618754 |
UniProt ID | Q9Y646 |
◆ Recombinant Proteins | ||
CPQ-4825C | Recombinant Chicken CPQ | +Inquiry |
Cpq-6771M | Recombinant Mouse Cpq Protein (Lys19-Ser470), C-His tagged | +Inquiry |
CPQ-1229R | Recombinant Rat CPQ Protein, His (Fc)-Avi-tagged | +Inquiry |
CPQ-1572R | Recombinant Rat CPQ Protein | +Inquiry |
Cpq-2295M | Recombinant Mouse Cpq Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPQ Products
Required fields are marked with *
My Review for All CPQ Products
Required fields are marked with *
0
Inquiry Basket