Recombinant Full Length Human CPN1 Protein, GST-tagged

Cat.No. : CPN1-2097HF
Product Overview : Human CPN1 full-length ORF ( NP_001299.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 458 amino acids
Description : Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits; this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency. [provided by RefSeq, Jul 2008]
Molecular Mass : 78.7 kDa
AA Sequence : MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CPN1 carboxypeptidase N, polypeptide 1 [ Homo sapiens ]
Official Symbol CPN1
Synonyms CPN1; carboxypeptidase N, polypeptide 1; carboxypeptidase N, polypeptide 1, 50kD; carboxypeptidase N catalytic chain; anaphylatoxin inactivator; arginine carboxypeptidase; carboxypeptidase K; kininase I; lysine carboxypeptidase; kininase-1; serum carboxypeptidase N; plasma carboxypeptidase B; carboxypeptidase N small subunit; carboxypeptidase N catalytic subunit; carboxypeptidase N polypeptide 1 50 kD; CPN; SCPN; FLJ40792
Gene ID 1369
mRNA Refseq NM_001308
Protein Refseq NP_001299
MIM 603103
UniProt ID P15169

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CPN1 Products

Required fields are marked with *

My Review for All CPN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon