Recombinant Full Length Human CPLX3 Protein, GST-tagged

• Cat.No.: CPLX3-2076HF
• Product Overview: Human CPLX3 full-length ORF (NP_001025176.1, 1 a.a. - 158 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 158 amino acids
• Description: CPLX3 (Complexin 3) is a Protein Coding gene. Diseases associated with CPLX3 include Acute Dacryocystitis and Chromosome 15Q24 Deletion Syndrome. Among its related pathways are Synaptic vesicle cycle. GO annotations related to this gene include syntaxin binding and neurotransmitter transporter activity. An important paralog of this gene is CPLX4.
• Molecular Mass: 44 kDa
• AA Sequence: MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CPLX3 complexin 3 [ Homo sapiens ]
• Official Symbol: CPLX3
• Synonyms: CPLX3; complexin 3; complexin-3; CPX III; complexin III; CPXIII; CPX-III; Nbla11589; FLJ00167; FLJ00250; FLJ13993; DKFZp434E1719
• Gene ID: 594855
• mRNA Refseq: NM_001030005
• Protein Refseq: NP_001025176
• MIM: 609585
• UniProt ID: Q8WVH0