Recombinant Full Length Human COX5B Protein, GST-tagged

Cat.No. : COX5B-2009HF
Product Overview : Human COX5B full-length ORF ( AAH06229.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 129 amino acids
Description : Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq, Jul 2008]
Molecular Mass : 39.82 kDa
AA Sequence : MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX5B cytochrome c oxidase subunit Vb [ Homo sapiens ]
Official Symbol COX5B
Synonyms COX5B; cytochrome c oxidase subunit Vb; cytochrome c oxidase subunit 5B, mitochondrial; cytochrome c oxidase polypeptide VB, mitochondrial; COXVB
Gene ID 1329
mRNA Refseq NM_001862
Protein Refseq NP_001853
MIM 123866
UniProt ID P10606

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COX5B Products

Required fields are marked with *

My Review for All COX5B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon