Recombinant Full Length Human COQ5 Protein, GST-tagged

• Cat.No.: COQ5-1976HF
• Product Overview: Human COQ5 full-length ORF (BAB71567.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 246 amino acids
• Description: COQ5 (Coenzyme Q5, Methyltransferase) is a Protein Coding gene. Among its related pathways are Ubiquinol biosynthesis and Metabolism. GO annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity.
• Molecular Mass: 54.3 kDa
• AA Sequence: MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDINKEMLKVGKQKALAQGHDRRCRLSQGDLRKSNIRHCGHSFWLQTLIPFLSWSMNQSYPVESLELKDNLANETAAEHLLLRIRALDSCLNRTVSKWKNKFLSLFYSFLWSCFSPSPRGIWSVSLLNC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COQ5 coenzyme Q5 homolog, methyltransferase (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: COQ5
• Synonyms: COQ5; coenzyme Q5 homolog, methyltransferase (S. cerevisiae); coenzyme Q5 homolog, methyltransferase (yeast); 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; 2 methoxy 6 polyprenyl 1; 4 benzoquinol methylase; MGC4767; ubiquinone biosynthesis methyltransferase COQ5, mitochondrial; MGC104303
• Gene ID: 84274
• mRNA Refseq: NM_032314
• Protein Refseq: NP_115690
• MIM: 616359
• UniProt ID: Q5HYK3