Recombinant Full Length Human COMTD1 Protein, GST-tagged

Cat.No. : COMTD1-1949HF
Product Overview : Human COMTD1 full-length ORF ( NP_653190.2, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : COMTD1 (Catechol-O-Methyltransferase Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include O-methyltransferase activity.
Molecular Mass : 55.2 kDa
Protein length : 262 amino acids
AA Sequence : MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMTD1 catechol-O-methyltransferase domain containing 1 [ Homo sapiens ]
Official Symbol COMTD1
Synonyms COMTD1; catechol-O-methyltransferase domain containing 1; catechol O-methyltransferase domain-containing protein 1; FLJ23841
Gene ID 118881
mRNA Refseq NM_144589
Protein Refseq NP_653190
UniProt ID Q86VU5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COMTD1 Products

Required fields are marked with *

My Review for All COMTD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon