Recombinant Full Length Human CNTFR Protein, C-Flag-tagged
Cat.No. : | CNTFR-1986HFL |
Product Overview : | Recombinant Full Length Human CNTFR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the type 1 cytokine receptor family. The encoded protein is the ligand-specific component of a tripartite receptor for ciliary neurotrophic factor, which plays a critical role in neuronal cell survival, differentiation and gene expression. Binding of ciliary neurotrophic factor to the encoded protein recruits the transmembrane components of the receptor, gp130 and leukemia inhibitory factor receptor, facilitating signal transduction. Single nucleotide polymorphisms in this gene may be associated with variations in muscle strength, as well as early onset of eating disorders. Alternatively spliced transcript variants have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.7 kDa |
AA Sequence : | MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLN GSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNT FNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENV VARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQV AAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPF LVSVPITLALAAAAATASSLLI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | CNTFR ciliary neurotrophic factor receptor [ Homo sapiens (human) ] |
Official Symbol | CNTFR |
Synonyms | MGC1774 |
Gene ID | 1271 |
mRNA Refseq | NM_147164.3 |
Protein Refseq | NP_671693.1 |
MIM | 118946 |
UniProt ID | P26992 |
◆ Recombinant Proteins | ||
CNTFR-1986HFL | Recombinant Full Length Human CNTFR Protein, C-Flag-tagged | +Inquiry |
CNTFR-3287H | Recombinant Human CNTFR Protein, MYC/DDK-tagged | +Inquiry |
CNTFR-12H | Recombinant Human CNTFR Protein (23-342aa), C-His-tagged | +Inquiry |
CNTFR-1253H | Active Recombinant Human CNTFR protein, His-tagged | +Inquiry |
CNTFR-1596H | Recombinant Human Ciliary Neurotrophic Factor Receptor | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTFR-687HCL | Recombinant Human CNTFR cell lysate | +Inquiry |
CNTFR-598RCL | Recombinant Rat CNTFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNTFR Products
Required fields are marked with *
My Review for All CNTFR Products
Required fields are marked with *
0
Inquiry Basket