Recombinant Full Length Human CNIH4 Protein, GST-tagged

• Cat.No.: CNIH4-5656HF
• Product Overview: Human HSPC163 full-length ORF ( AAH00573, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CNIH4 (Cornichon Family AMPA Receptor Auxiliary Protein 4) is a Protein Coding gene. GO annotations related to this gene include CCR5 chemokine receptor binding. An important paralog of this gene is CNIH1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 41.03 kDa
• Protein length: 139 amino acids
• AA Sequence: MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNIH4 cornichon homolog 4 (Drosophila) [ Homo sapiens ]
• Official Symbol: CNIH4
• Synonyms: CNIH4; cornichon homolog 4 (Drosophila); protein cornichon homolog 4; HSPC163
• Gene ID: 29097
• mRNA Refseq: NM_014184
• Protein Refseq: NP_054903
• MIM: 617483
• UniProt ID: Q9P003