Recombinant Full Length Human CMTM6 Protein, C-Flag-tagged

Cat.No. : CMTM6-1363HFL
Product Overview : Recombinant Full Length Human CMTM6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 20.2 kDa
AA Sequence : MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF
GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transmembrane
Full Length : Full L.
Gene Name CMTM6 CKLF like MARVEL transmembrane domain containing 6 [ Homo sapiens (human) ]
Official Symbol CMTM6
Synonyms CKLFSF6; PRO2219
Gene ID 54918
mRNA Refseq NM_017801.3
Protein Refseq NP_060271.1
MIM 607889
UniProt ID Q9NX76

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CMTM6 Products

Required fields are marked with *

My Review for All CMTM6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon