Recombinant Full Length Human CMAS Protein, GST-tagged

• Cat.No.: CMAS-1899HF
• Product Overview: Human CMAS full-length ORF ( AAH16609.1, 1 a.a. - 263 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an enzyme that converts N-acetylneuraminic acid (NeuNAc) to cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-NeuNAc). This process is important in the formation of sialylated glycoprotein and glycolipids. This modification plays a role in cell-cell communications and immune responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 56 kDa
• Protein length: 263 amino acids
• AA Sequence: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMAS cytidine monophosphate N-acetylneuraminic acid synthetase [ Homo sapiens ]
• Official Symbol: CMAS
• Synonyms: CMAS; cytidine monophosphate N-acetylneuraminic acid synthetase; N-acylneuraminate cytidylyltransferase; CMP Neu5Ac synthetase; CMP-NeuNAc synthase; CMP-Neu5Ac synthetase; CMP-NeuNAc synthetase; CMP-N-acetylneuraminic acid synthase; CMP-N-acetylneuraminic acid synthetase; cytidine 5-monophosphate N-acetylneuraminic acid synthetase
• Gene ID: 55907
• mRNA Refseq: NM_018686
• Protein Refseq: NP_061156
• MIM: 603316
• UniProt ID: Q8NFW8