Recombinant Full Length Human CLPP Protein, GST-tagged

• Cat.No.: CLPP-1887HF
• Product Overview: Human CLPP full-length ORF ( NP_006003.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 56.6 kDa
• Protein length: 277 amino acids
• AA Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLPP ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) [ Homo sapiens ]
• Official Symbol: CLPP
• Synonyms: CLPP; ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli); ClpP (caseinolytic protease, ATP dependent, proteolytic subunit, E. coli) homolog , ClpP caseinolytic protease, ATP dependent, proteolytic subunit homolog (E. coli); putative ATP-dependent Clp protease proteolytic subunit, mitochondrial; ATP dependent protease ClpAP (E. coli); proteolytic subunit; human; endopeptidase Clp; ATP-dependent protease ClpAP, proteolytic subunit, human; ClpP caseinolytic peptidase ATP-dependent, proteolytic subunit; ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog
• Gene ID: 8192
• mRNA Refseq: NM_006012
• Protein Refseq: NP_006003
• MIM: 601119
• UniProt ID: Q16740