Recombinant Full Length Human CKMT2 Protein
Cat.No. : | CKMT2-86HF |
Product Overview : | Recombinant full length Human CKMT2 with N terminal proprietary tag, 71.83kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 419 amino acids |
Description : | Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 71.830kDa inclusive of tags |
AA Sequence : | MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAE VREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKV TPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA DLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYV LSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLK GDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG MARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNM KRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSN LGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD TAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKK LERGQDIKVPPPLPQFGKK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CKMT2 creatine kinase, mitochondrial 2 (sarcomeric) [ Homo sapiens ] |
Official Symbol | CKMT2 |
Synonyms | CKMT2; creatine kinase, mitochondrial 2 (sarcomeric); creatine kinase S-type, mitochondrial; SMTCK |
Gene ID | 1160 |
mRNA Refseq | NM_001099735 |
Protein Refseq | NP_001093205 |
MIM | 123295 |
UniProt ID | P17540 |
◆ Recombinant Proteins | ||
CKMT2-4025C | Recombinant Chicken CKMT2 | +Inquiry |
CKMT2-1710M | Recombinant Mouse CKMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ckmt2-2085M | Recombinant Mouse Ckmt2 protein, His&Myc-tagged | +Inquiry |
Ckmt2-2173M | Recombinant Mouse Ckmt2 Protein, Myc/DDK-tagged | +Inquiry |
CKMT2-2923H | Recombinant Human CKMT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKMT2-7481HCL | Recombinant Human CKMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CKMT2 Products
Required fields are marked with *
My Review for All CKMT2 Products
Required fields are marked with *
0
Inquiry Basket