Recombinant Full Length Human CIDEC Protein, GST-tagged

• Cat.No.: CIDEC-1850HF
• Product Overview: Human CIDEC full-length ORF ( AAH16851, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the cell death-inducing DNA fragmentation factor-like effector family. Members of this family play important roles in apoptosis. The encoded protein promotes lipid droplet formation in adipocytes and may mediate adipocyte apoptosis. This gene is regulated by insulin and its expression is positively correlated with insulin sensitivity. Mutations in this gene may contribute to insulin resistant diabetes. A pseudogene of this gene is located on the short arm of chromosome 3. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51.92 kDa
• Protein length: 238 amino acids
• AA Sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CIDEC cell death-inducing DFFA-like effector c [ Homo sapiens ]
• Official Symbol: CIDEC
• Synonyms: CIDEC; cell death-inducing DFFA-like effector c; cell death activator CIDE-3; CIDE 3; FLJ20871; Fsp27; fat specific protein 27; CIDE3; FSP27; CIDE-3
• Gene ID: 63924
• mRNA Refseq: NM_001199551
• Protein Refseq: NP_001186480
• MIM: 612120
• UniProt ID: Q96AQ7