Recombinant Full Length Human CIB2 Protein, GST-tagged

• Cat.No.: CIB2-1841HF
• Product Overview: Human CIB2 full-length ORF (AAH47381.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 187 amino acids
• Description: The protein encoded by this gene is similar to that of KIP/CIB, calcineurin B, and calmodulin. The encoded protein is a calcium-binding regulatory protein that interacts with DNA-dependent protein kinase catalytic subunits (DNA-PKcs), and it is involved in photoreceptor cell maintenance. Mutations in this gene cause deafness, autosomal recessive, 48 (DFNB48), and also Usher syndrome 1J (USH1J). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Molecular Mass: 46.97 kDa
• AA Sequence: MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CIB2 calcium and integrin binding family member 2 [ Homo sapiens ]
• Official Symbol: CIB2
• Synonyms: CIB2; calcium and integrin binding family member 2; calcium and integrin-binding family member 2; KIP2; KIP 2; 2810434I23Rik; kinase-interacting protein 2; DNA-dependent protein kinase catalytic subunit-interacting protein 2
• Gene ID: 10518
• mRNA Refseq: NM_006383
• Protein Refseq: NP_006374
• MIM: 605564
• UniProt ID: O75838