Recombinant Full Length Human CHORDC1 Protein, GST-tagged

• Cat.No.: CHORDC1-3213HF
• Product Overview: Human CHORDC1 full-length ORF (AAH72461.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 332 amino acids
• Description: CHORDC1 (Cysteine And Histidine Rich Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include Hsp90 protein binding. An important paralog of this gene is ITGB1BP2.
• Molecular Mass: 63.9 kDa
• AA Sequence: MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPAAKKQEKQKDATTD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHORDC1 cysteine and histidine-rich domain (CHORD) containing 1 [ Homo sapiens ]
• Official Symbol: CHORDC1
• Synonyms: CHORDC1; cysteine and histidine-rich domain (CHORD) containing 1; cysteine and histidine rich domain (CHORD) containing 1, cysteine and histidine rich domain (CHORD) containing, zinc binding protein 1; cysteine and histidine-rich domain-containing protein 1; CHP1; CHP-1; protein morgana; CHORD-containing protein 1; chord domain-containing protein 1; cysteine and histidine-rich domain (CHORD)-containing 1; cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1; FLJ37289
• Gene ID: 26973
• mRNA Refseq: NM_001144073
• Protein Refseq: NP_001137545
• MIM: 604353
• UniProt ID: Q9UHD1