Recombinant Full Length Human CHAC2 Protein, C-Flag-tagged

Cat.No. : CHAC2-1084HFL
Product Overview : Recombinant Full Length Human CHAC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 20.7 kDa
AA Sequence : MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVG KEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGR
NTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name CHAC2 ChaC glutathione specific gamma-glutamylcyclotransferase 2 [ Homo sapiens (human) ]
Official Symbol CHAC2
Synonyms GCG1
Gene ID 494143
mRNA Refseq NM_001008708.4
Protein Refseq NP_001008708.1
MIM 617446
UniProt ID Q8WUX2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHAC2 Products

Required fields are marked with *

My Review for All CHAC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon