Recombinant Full Length Human CFLAR Protein, GST-tagged

• Cat.No.: CFLAR-3298HF
• Product Overview: Human CFLAR full-length ORF (AAH01602.1, 1 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 480 amino acids
• Description: The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists. [provided by RefSeq, Feb 2011]
• Molecular Mass: 78.43 kDa
• AA Sequence: MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CFLAR CASP8 and FADD-like apoptosis regulator [ Homo sapiens ]
• Official Symbol: CFLAR
• Synonyms: CFLAR; CASP8 and FADD-like apoptosis regulator; CASP8AP1; c FLIP; CASH; Casper; CLARP; FLAME; FLIP; I FLICE; MRIT; usurpin beta; caspase homolog; inhibitor of FLICE; caspase-eight-related protein; MACH-related inducer of toxicity; FADD-like anti-apoptotic molecule; FADD-like antiapoptotic molecule 1; caspase-related inducer of apoptosis; cellular FLICE-like inhibitory protein; caspase-like apoptosis regulatory protein; FLAME1; c-FLIP; FLAME-1; I-FLICE; c-FLIPL; c-FLIPR; c-FLIPS
• Gene ID: 8837
• mRNA Refseq: NM_001127183
• Protein Refseq: NP_001120655
• MIM: 603599
• UniProt ID: O15519