Recombinant Full Length Human CFDP1 Protein, GST-tagged

• Cat.No.: CFDP1-3294HF
• Product Overview: Human CFDP1 full-length ORF (NP_006315.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CFDP1 (Craniofacial Development Protein 1) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 60 kDa
• Protein length: 299 amino acids
• AA Sequence: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CFDP1 craniofacial development protein 1 [ Homo sapiens ]
• Official Symbol: CFDP1
• Synonyms: CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR
• Gene ID: 10428
• mRNA Refseq: NM_006324
• Protein Refseq: NP_006315
• MIM: 608108
• UniProt ID: Q9UEE9