Recombinant Full Length Human CFAP300 Protein, GST-tagged

Cat.No. : CFAP300-1875HF
Product Overview : Human CFAP300 full-length ORF ( NP_116319.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 229 amino acids
Description : Predicted to be located in cytoplasm and motile cilium. Implicated in primary ciliary dyskinesia 38.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 52.9 kDa
AA Sequence : MLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFAP300 cilia and flagella associated protein 300 [ Homo sapiens (human) ]
Official Symbol CFAP300
Synonyms C11orf70
Gene ID 85016
mRNA Refseq NM_032930.2
Protein Refseq NP_116319.2
MIM 618058
UniProt ID Q9BRQ4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CFAP300 Products

Required fields are marked with *

My Review for All CFAP300 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon