Recombinant Full Length Human CFAP300 Protein, GST-tagged
Cat.No. : | CFAP300-1875HF |
Product Overview : | Human CFAP300 full-length ORF ( NP_116319.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
ProteinLength : | 229 amino acids |
Description : | Predicted to be located in cytoplasm and motile cilium. Implicated in primary ciliary dyskinesia 38. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 52.9 kDa |
AA Sequence : | MLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFAP300 cilia and flagella associated protein 300 [ Homo sapiens (human) ] |
Official Symbol | CFAP300 |
Synonyms | C11orf70 |
Gene ID | 85016 |
mRNA Refseq | NM_032930.2 |
Protein Refseq | NP_116319.2 |
MIM | 618058 |
UniProt ID | Q9BRQ4 |
◆ Recombinant Proteins | ||
HTT-3873H | Recombinant Human HTT protein, His-tagged | +Inquiry |
SNX27B-10825Z | Recombinant Zebrafish SNX27B | +Inquiry |
HA-187H | Recombinant Influenza A H1N1 (A/Memphis/1/1987) HA1 Protein, His-tagged | +Inquiry |
NLK-10711M | Recombinant Mouse NLK Protein | +Inquiry |
RFL33185HF | Recombinant Full Length Human Leucine-Rich Repeat-Containing Protein 8E(Lrrc8E) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
CAT-75H | Native Human Catalase | +Inquiry |
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACADVL-9111HCL | Recombinant Human ACADVL 293 Cell Lysate | +Inquiry |
RHBDD3-2363HCL | Recombinant Human RHBDD3 293 Cell Lysate | +Inquiry |
HIGD2A-5560HCL | Recombinant Human HIGD2A 293 Cell Lysate | +Inquiry |
TRAPPC1-810HCL | Recombinant Human TRAPPC1 293 Cell Lysate | +Inquiry |
SLAMF1-1004RCL | Recombinant Rat SLAMF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFAP300 Products
Required fields are marked with *
My Review for All CFAP300 Products
Required fields are marked with *
0
Inquiry Basket