Recombinant Full Length Human CETN3 Protein, GST-tagged

Cat.No. : CETN3-3290HF
Product Overview : Human CETN3 full-length ORF (NP_004356.2, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 167 amino acids
Description : The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Molecular Mass : 45.9 kDa
AA Sequence : MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CETN3 centrin, EF-hand protein, 3 [ Homo sapiens ]
Official Symbol CETN3
Synonyms CETN3; centrin, EF-hand protein, 3; centrin, EF hand protein, 3 (CDC31 yeast homolog); centrin-3; CDC31 yeast homolog; CEN3; EF hand superfamily member; EF-hand superfamily member; centrin, EF-hand protein, 3 (CDC31 homolog, yeast); MGC12502; MGC138245;
Gene ID 1070
mRNA Refseq NM_004365
Protein Refseq NP_004356
MIM 602907
UniProt ID O15182

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CETN3 Products

Required fields are marked with *

My Review for All CETN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon