Recombinant Full Length Human CETN3 Protein, GST-tagged

• Cat.No.: CETN3-3290HF
• Product Overview: Human CETN3 full-length ORF (NP_004356.2, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.9 kDa
• Protein length: 167 amino acids
• AA Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CETN3 centrin, EF-hand protein, 3 [ Homo sapiens ]
• Official Symbol: CETN3
• Synonyms: CETN3; centrin, EF-hand protein, 3; centrin, EF hand protein, 3 (CDC31 yeast homolog); centrin-3; CDC31 yeast homolog; CEN3; EF hand superfamily member; EF-hand superfamily member; centrin, EF-hand protein, 3 (CDC31 homolog, yeast); MGC12502; MGC138245
• Gene ID: 1070
• mRNA Refseq: NM_004365
• Protein Refseq: NP_004356
• MIM: 602907
• UniProt ID: O15182