Recombinant Full Length Human CENPW Protein, GST-tagged

Cat.No. : CENPW-3912HF
Product Overview : Human CENPW full-length ORF (NP_001012525.1, 1 a.a. - 88 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 88 amino acids
Description : CENPW (Centromere Protein W) is a Protein Coding gene. Among its related pathways are Chromosome Maintenance and Cell Cycle, Mitotic. GO annotations related to this gene include protein heterodimerization activity.
Molecular Mass : 36.08 kDa
AA Sequence : MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CENPW centromere protein W [ Homo sapiens (human) ]
Official Symbol CENPW
Synonyms CENPW; centromere protein W; CUG2; CENP-W; C6orf173; centromere protein W; cancer-up-regulated gene 2 protein; cancer-upregulated gene 2
Gene ID 387103
mRNA Refseq NM_001012507
Protein Refseq NP_001012525
MIM 611264
UniProt ID Q5EE01

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CENPW Products

Required fields are marked with *

My Review for All CENPW Products

Required fields are marked with *

0

Inquiry Basket

cartIcon