Recombinant Full Length Human CELA3A Protein, GST-tagged

• Cat.No.: CELA3A-4328HF
• Product Overview: Human ELA3A full-length ORF ( AAH07028, 16 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 53.79 kDa
• Protein length: 16-270 amino acids
• AA Sequence: SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CELA3A chymotrypsin like elastase family member 3A [ Homo sapiens (human) ]
• Official Symbol: CELA3A
• Synonyms: CELA3A; chymotrypsin like elastase family member 3A; Chymotrypsin Like Elastase Family Member 3A; Protease E; Elastase 3A, Pancreatic; Elastase IIIA; Elastase-3A; ELA3A; ELA3; Chymotrypsin-Like Elastase Family, Member 3A; Chymotrypsin-Like Elastase Family Member 3A; Elastase 3A, Pancreatic (Protease E); EC 3.4.21.70; Elastase 1; EC 3.4.21; chymotrypsin-like elastase family member 3A; elastase 1; elastase 3A, pancreatic; elastase IIIA; elastase-3A; protease E
• Gene ID: 10136
• mRNA Refseq: NM_005747
• Protein Refseq: NP_005738
• MIM: 618693
• UniProt ID: P09093