Recombinant Full Length Human CDK20 Protein, GST-tagged
Cat.No. : | CDK20-3780HF |
Product Overview : | Human CCRK full-length ORF ( AAH02655, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 275 amino acids |
Description : | The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Dec 2009] |
Molecular Mass : | 55.99 kDa |
AA Sequence : | MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDK20 cyclin dependent kinase 20 [ Homo sapiens (human) ] |
Official Symbol | CDK20 |
Synonyms | CCRK; CDK20; cyclin dependent kinase 20; P42; CCRK; CDCH; PNQALRE; cyclin-dependent kinase 20; CAK-kinase p42; CDK-activating kinase p42; cell cycle-related kinase; cell division protein kinase 20; cyclin-dependent protein kinase H; cyclin-kinase-activating kinase p42; EC 2.7.11.22 |
Gene ID | 23552 |
mRNA Refseq | NM_001039803 |
Protein Refseq | NP_001034892 |
MIM | 610076 |
UniProt ID | Q8IZL9 |
◆ Recombinant Proteins | ||
CDK20-961R | Recombinant Rat CDK20 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdk20-1250M | Recombinant Mouse Cdk20 protein, His & T7-tagged | +Inquiry |
CDK20-468H | Recombinant Human CDK20 Protein, His-tagged | +Inquiry |
CDK20-1303R | Recombinant Rat CDK20 Protein | +Inquiry |
CDK20-608R | Recombinant Rhesus Macaque CDK20 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK20-7629HCL | Recombinant Human CDK20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK20 Products
Required fields are marked with *
My Review for All CDK20 Products
Required fields are marked with *
0
Inquiry Basket