Recombinant Full Length Human CD70 Protein

• Cat.No.: CD70-3030HF
• Product Overview: Human CD70 full-length ORF (NP_001243.1) recombinant protein without tag.

Specification

• Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 21.1 kDa
• Protein length: 392 amino acids
• AA Sequence: MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD70 CD70 molecule [ Homo sapiens ]
• Official Symbol: CD70
• Synonyms: CD70; CD70 molecule; CD27LG, TNFSF7, tumor necrosis factor (ligand) superfamily, member 7; CD70 antigen; CD27L; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7; CD27LG; TNFSF7
• Gene ID: 970
• mRNA Refseq: NM_001252
• Protein Refseq: NP_001243
• MIM: 602840
• UniProt ID: P32970