Recombinant Full Length Human CD3D Protein

• Cat.No.: CD3D-3172HF
• Product Overview: Human CD3D full-length ORF (NP_000723.1) recombinant protein without tag.

Specification

• Description: The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq, Feb 2009]
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 18.9 kDa
• Protein length: 597 amino acids
• AA Sequence: MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD3D CD3d molecule, delta (CD3-TCR complex) [ Homo sapiens ]
• Official Symbol: CD3D
• Synonyms: CD3D; CD3d molecule, delta (CD3-TCR complex); CD3d antigen, delta polypeptide (TiT3 complex), T3D; T-cell surface glycoprotein CD3 delta chain; CD3 delta; OKT3, delta chain; CD3 antigen, delta subunit; T-cell receptor T3 delta chain; CD3d antigen, delta polypeptide (TiT3 complex); T3D; CD3-DELTA
• Gene ID: 915
• mRNA Refseq: NM_000732
• Protein Refseq: NP_000723
• MIM: 186790
• UniProt ID: P04234