Recombinant Full Length Human CD3D Protein

Cat.No. : CD3D-3172HF
Product Overview : Human CD3D full-length ORF (NP_000723.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq, Feb 2009]
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 18.9 kDa
Protein length : 597 amino acids
AA Sequence : MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Applications : Antibody Production
Functional Study
Compound Screening
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CD3D CD3d molecule, delta (CD3-TCR complex) [ Homo sapiens ]
Official Symbol CD3D
Synonyms CD3D; CD3d molecule, delta (CD3-TCR complex); CD3d antigen, delta polypeptide (TiT3 complex), T3D; T-cell surface glycoprotein CD3 delta chain; CD3 delta; OKT3, delta chain; CD3 antigen, delta subunit; T-cell receptor T3 delta chain; CD3d antigen, delta polypeptide (TiT3 complex); T3D; CD3-DELTA;
Gene ID 915
mRNA Refseq NM_000732
Protein Refseq NP_000723
MIM 186790
UniProt ID P04234

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD3D Products

Required fields are marked with *

My Review for All CD3D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon