Recombinant Full Length Human CD34 Protein, GST-tagged
Cat.No. : | CD34-3163HF |
Product Overview : | Human CD34 full-length ORF (NP_001764.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 328 amino acids |
Description : | The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 61.71 kDa |
AA Sequence : | MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLELEP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD34 CD34 molecule [ Homo sapiens ] |
Official Symbol | CD34 |
Synonyms | CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34; |
Gene ID | 947 |
mRNA Refseq | NM_001025109 |
Protein Refseq | NP_001020280 |
MIM | 142230 |
UniProt ID | P28906 |
◆ Recombinant Proteins | ||
CD34-3650H | Recombinant Human CD34 protein, His-tagged | +Inquiry |
CD34-01H | Active Recombinant Human CD34 protein, His-tagged | +Inquiry |
CD34-152H | Recombinant Human CD34 Protein, DYKDDDDK-tagged | +Inquiry |
CD34-2632H | Recombinant Human CD34 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD34-266H | Recombinant Human CD34 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
CD34-2232MCL | Recombinant Mouse CD34 cell lysate | +Inquiry |
CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD34 Products
Required fields are marked with *
My Review for All CD34 Products
Required fields are marked with *
0
Inquiry Basket