Recombinant Full Length Human CD1B Protein

Cat.No. : CD1B-61HF
Product Overview : Recombinant full length Human CD1b (amino acids 1-333) with N terminal proprietary tag, 62.7kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 333 amino acids
Description : This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens.
Form : Liquid
Molecular Mass : 62.700kDa inclusive of tags
AA Sequence : MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNST WAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKE VAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC ELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQ KFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQ RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLA LWYMRRRSYQNIP
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name CD1B CD1b molecule [ Homo sapiens ]
Official Symbol CD1B
Synonyms CD1B; CD1b molecule; CD1, CD1b antigen , CD1B antigen, b polypeptide; T-cell surface glycoprotein CD1b
Gene ID 910
mRNA Refseq NM_001764
Protein Refseq NP_001755
MIM 188360
UniProt ID P29016

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD1B Products

Required fields are marked with *

My Review for All CD1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon