Recombinant Full Length Human CCL28 Protein, GST-tagged

• Cat.No.: CCL28-2948HF
• Product Overview: Human CCL28 full-length ORF (BAG35056.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 127 amino acids
• Description: This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
• Molecular Mass: 40.37 kDa
• AA Sequence: MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCL28 chemokine (C-C motif) ligand 28 [ Homo sapiens ]
• Official Symbol: CCL28
• Synonyms: CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK1; MEC; mucosae associated epithelial chemokine; SCYA28; small inducible cytokine A28; small inducible cytokine subfamily A (Cys Cys); member 28; small-inducible cytokine A28; mucosae-associated epithelial chemokine; chemokine (C-C motif) ligand 28 splice variant chi; small inducible cytokine subfamily A (Cys-Cys), member 28; MGC71902
• Gene ID: 56477
• mRNA Refseq: NM_148672
• Protein Refseq: NP_683513
• MIM: 605240
• UniProt ID: Q9NRJ3