Recombinant Full Length Human CCDC68 Protein, GST-tagged
Cat.No. : | CCDC68-2875HF |
Product Overview : | Human CCDC68 full-length ORF (NP_079490.1, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 335 amino acids |
Description : | CCDC68 (Coiled-Coil Domain Containing 68) is a Protein Coding gene. Diseases associated with CCDC68 include Cutaneous T Cell Lymphoma. |
Molecular Mass : | 65.3 kDa |
AA Sequence : | MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIENLREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC68 coiled-coil domain containing 68 [ Homo sapiens ] |
Official Symbol | CCDC68 |
Synonyms | CCDC68; coiled-coil domain containing 68; coiled-coil domain-containing protein 68; cutaneous T cell lymphoma associated antigen; SE57 1; CTCL tumor antigen se57-1; CTCL-associated antigen se57-1; cutaneous T-cell lymphoma associated antigen; cutaneous T-cell lymphoma-associated antigen se57-1; SE57-1; FLJ25368; |
Gene ID | 80323 |
mRNA Refseq | NM_001143829 |
Protein Refseq | NP_001137301 |
MIM | 616909 |
UniProt ID | Q9H2F9 |
◆ Recombinant Proteins | ||
CCDC68-1359M | Recombinant Mouse CCDC68 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC68-2515HFL | Recombinant Full Length Human CCDC68 protein, Flag-tagged | +Inquiry |
CCDC68-2919M | Recombinant Mouse CCDC68 Protein | +Inquiry |
CCDC68-0571H | Recombinant Human CCDC68 Protein, GST-Tagged | +Inquiry |
CCDC68-12H | Recombinant Human CCDC68 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC68-7754HCL | Recombinant Human CCDC68 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC68 Products
Required fields are marked with *
My Review for All CCDC68 Products
Required fields are marked with *
0
Inquiry Basket