Recombinant Full Length Human CCDC68 Protein, GST-tagged

• Cat.No.: CCDC68-2875HF
• Product Overview: Human CCDC68 full-length ORF (NP_079490.1, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CCDC68 (Coiled-Coil Domain Containing 68) is a Protein Coding gene. Diseases associated with CCDC68 include Cutaneous T Cell Lymphoma.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 65.3 kDa
• Protein length: 335 amino acids
• AA Sequence: MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIENLREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC68 coiled-coil domain containing 68 [ Homo sapiens ]
• Official Symbol: CCDC68
• Synonyms: CCDC68; coiled-coil domain containing 68; coiled-coil domain-containing protein 68; cutaneous T cell lymphoma associated antigen; SE57 1; CTCL tumor antigen se57-1; CTCL-associated antigen se57-1; cutaneous T-cell lymphoma associated antigen; cutaneous T-cell lymphoma-associated antigen se57-1; SE57-1; FLJ25368
• Gene ID: 80323
• mRNA Refseq: NM_001143829
• Protein Refseq: NP_001137301
• MIM: 616909
• UniProt ID: Q9H2F9