Recombinant Full Length Human CCDC106 Protein, GST-tagged

Cat.No. : CCDC106-2815HF
Product Overview : Human CCDC106 full-length ORF (NP_037433.2, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 280 amino acids
Description : CCDC106 (Coiled-Coil Domain Containing 106) is a Protein Coding gene.
Molecular Mass : 58.4 kDa
AA Sequence : MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC106 coiled-coil domain containing 106 [ Homo sapiens ]
Official Symbol CCDC106
Synonyms CCDC106; coiled-coil domain containing 106; coiled-coil domain-containing protein 106; HSU79303; protein predicted by clone 23882; ZNF581;
Gene ID 29903
mRNA Refseq NM_013301
Protein Refseq NP_037433
MIM 613478
UniProt ID Q9BWC9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC106 Products

Required fields are marked with *

My Review for All CCDC106 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon