Recombinant Full Length Human CBLN4 Protein, GST-tagged

• Cat.No.: CBLN4-2772HF
• Product Overview: Human CBLN4 full-length ORF (NP_542184.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 201 amino acids
• Description: This gene encodes a member of a family of small secreted proteins containing C1Q domains. Members of this family are involved in regulation of neurexin signalling during synapse development. The mouse homolog of the protein encoded by this gene competes with netrin to bind to the deleted in colorectal cancer receptor. [provided by RefSeq, Aug 2012]
• Molecular Mass: 48.2 kDa
• AA Sequence: MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CBLN4 cerebellin 4 precursor [ Homo sapiens ]
• Official Symbol: CBLN4
• Synonyms: CBLN4; cerebellin 4 precursor; CBLNL1, cerebellin precursor like 1; cerebellin-4; dJ885A10.1; cerebellin precursor-like 1; cerebellin-like glycoprotein 1; CBLNL1
• Gene ID: 140689
• mRNA Refseq: NM_080617
• Protein Refseq: NP_542184
• MIM: 615029
• UniProt ID: Q9NTU7