Recombinant Full Length Human CASP7 Protein, GST-tagged
Cat.No. : | CASP7-2738HF |
Product Overview : | Human CASP7 full-length ORF (NP_203124.1, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 336 amino acids |
Description : | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQMADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CASP7 caspase 7, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP7 |
Synonyms | CASP7; caspase 7, apoptosis-related cysteine peptidase; caspase 7, apoptosis related cysteine protease; caspase-7; CMH 1; ICE LAP3; MCH3; CASP-7; Lice2 alpha/beta/gamma; caspase 7 isoform delta; apoptotic protease MCH-3; ICE-like apoptotic protease 3; caspase 7, apoptosis-related cysteine protease; CMH-1; ICE-LAP3; |
Gene ID | 840 |
mRNA Refseq | NM_001227 |
Protein Refseq | NP_001218 |
MIM | 601761 |
UniProt ID | P55210 |
◆ Recombinant Proteins | ||
Casp7-772M | Recombinant Mouse Casp7 Protein, MYC/DDK-tagged | +Inquiry |
CASP7-681H | Recombinant Human CASP7 Protein, His-tagged | +Inquiry |
CASP7-2786Z | Recombinant Zebrafish CASP7 | +Inquiry |
CASP7-0429H | Active Recombinant Human CASP7 Protein | +Inquiry |
CASP7-6396H | Recombinant Human CASP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP7-7832HCL | Recombinant Human CASP7 293 Cell Lysate | +Inquiry |
CASP7-7833HCL | Recombinant Human CASP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASP7 Products
Required fields are marked with *
My Review for All CASP7 Products
Required fields are marked with *
0
Inquiry Basket