Recombinant Full Length Human CARTPT Protein, GST-tagged

• Cat.No.: CARTPT-2899HF
• Product Overview: Human CART full-length ORF (AAH29882, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 116 amino acids
• Description: This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans. [provided by RefSeq, Feb 2016]
• Molecular Mass: 38.5 kDa
• AA Sequence: MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CARTPT CART prepropeptide [ Homo sapiens ]
• Official Symbol: CARTPT
• Synonyms: CARTPT; CART prepropeptide; cocaine- and amphetamine-regulated transcript protein; CART; cocaine and amphetamine regulated transcript
• Gene ID: 9607
• mRNA Refseq: NM_004291
• Protein Refseq: NP_004282
• MIM: 602606
• UniProt ID: Q16568