Recombinant Full Length Human CAPZA1 Protein, C-Flag-tagged

• Cat.No.: CAPZA1-1381HFL
• Product Overview: Recombinant Full Length Human CAPZA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 32.7 kDa
• AA Sequence: MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG
  KEMQNATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: CAPZA1 capping actin protein of muscle Z-line subunit alpha 1 [ Homo sapiens (human) ]
• Official Symbol: CAPZA1
• Synonyms: CAPZ; CAZ1; CAPPA1
• Gene ID: 829
• mRNA Refseq: NM_006135.3
• Protein Refseq: NP_006126.1
• MIM: 601580
• UniProt ID: P52907