Recombinant Full Length Human CAMP Protein, C-Flag-tagged
Cat.No. : | CAMP-299HFL |
Product Overview : | Recombinant Full Length Human CAMP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.1 kDa |
AA Sequence : | MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR KSKEKIGKEFKRIVQRIKDFLRNLVPRTESTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | CAMP cathelicidin antimicrobial peptide [ Homo sapiens (human) ] |
Official Symbol | CAMP |
Synonyms | LL37; CAP18; CRAMP; HSD26; CAP-18; FALL39; FALL-39 |
Gene ID | 820 |
mRNA Refseq | NM_004345.5 |
Protein Refseq | NP_004336.4 |
MIM | 600474 |
UniProt ID | P49913 |
◆ Recombinant Proteins | ||
CAMP-2767H | Recombinant Human CAMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CAMP-447R | Recombinant Rhesus Macaque CAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMP-2200C | Recombinant Chicken CAMP | +Inquiry |
Camp-661M | Recombinant Mouse Camp Protein, His/GST-tagged | +Inquiry |
Camp-360M | Recombinant Mouse Camp Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAMP Products
Required fields are marked with *
My Review for All CAMP Products
Required fields are marked with *
0
Inquiry Basket