Recombinant Full Length Human calcium binding protein 1 protein, His&T7 tagged

• Cat.No.: CABP1-1119H
• Product Overview: Recombinant Full Length Human CABP1 protein (1-370aa) with N-His&T7 tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 1-370aa
• Description: Calcium binding proteins are an important component of calcium mediated cellular signal transduction. This gene encodes a protein that belongs to a subfamily of calcium binding proteins which share similarity to calmodulin. The protein encoded by this gene regulates the gating of voltage-gated calcium ion channels. This protein inhibits calcium-dependent inactivation and supports calcium-dependent facilitation of ion channels containing voltage-dependent L-type calcium channel subunit alpha-1C. This protein also regulates calcium-dependent activity of inositol 1, 4, 5-triphosphate receptors, P/Q-type voltage-gated calcium channels, and transient receptor potential channel TRPC5. This gene is predominantly expressed in retina and brain. Alternative splicing results in multiple transcript variants encoding disinct isoforms.
• Tag: N-His&T7
• Molecular Mass: 22 kDa
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGFGNCVKYPLRNLSRKDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from 50mM Tris, 300mM NaCl, pH8.5, 5% Trehalose
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.49 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.

Gene Information

• Gene Name: CABP1 calcium binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: CABP1
• Synonyms: CABP1; calcium binding protein 1; CALBRAIN; HCALB_BR; calcium-binding protein 1; calcium binding protein 5; caldendrin
• Gene ID: 9478
• mRNA Refseq: NM_031205
• Protein Refseq: NP_112482
• MIM: 605563
• UniProt ID: Q9NZU7