Recombinant Full Length Human CALB1 Protein, GST-tagged

Cat.No. : CALB1-3045HF
Product Overview : Human CALB1 full-length ORF (NP_004920.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease. [provided by RefSeq, Jan 2015]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 56.4 kDa
Protein length : 261 amino acids
AA Sequence : MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CALB1 calbindin 1, 28kDa [ Homo sapiens ]
Official Symbol CALB1
Synonyms CALB1; calbindin 1, 28kDa; CALB; calbindin; D-28K; calbindin D28; RTVL-H protein; calbindin 1, (28kD); vitamin D-dependent calcium-binding protein, avian-type;
Gene ID 793
mRNA Refseq NM_004929
Protein Refseq NP_004920
MIM 114050
UniProt ID P05937

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CALB1 Products

Required fields are marked with *

My Review for All CALB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon