Recombinant Full Length Human CA8 Protein, GST-tagged
Cat.No. : | CA8-2744HF |
Product Overview : | Human CA8 full-length ORF (NP_004047.3, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 290 amino acids |
Description : | The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. Mutations in this gene are associated with cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3). Polymorphisms in this gene are associated with osteoporosis, and overexpression of this gene in osteosarcoma cells suggests an oncogenic role. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 59.4 kDa |
AA Sequence : | MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA8 carbonic anhydrase VIII [ Homo sapiens ] |
Official Symbol | CA8 |
Synonyms | CA8; carbonic anhydrase VIII; CALS; carbonic anhydrase-related protein; CARP; CA-related protein; carbonate dehydratase; carbonic anhydrase-like sequence; CAMRQ3; CA-VIII; MGC99509; MGC120502; |
Gene ID | 767 |
mRNA Refseq | NM_004056 |
Protein Refseq | NP_004047 |
MIM | 114815 |
UniProt ID | P35219 |
◆ Recombinant Proteins | ||
CAR8-1136R | Recombinant Rat CAR8 Protein | +Inquiry |
Car8-749M | Recombinant Mouse Car8 Protein, MYC/DDK-tagged | +Inquiry |
CA8-426R | Recombinant Rhesus Macaque CA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Car8-909M | Active Recombinant Mouse Car8 protein(Met1-Gln291), His-tagged | +Inquiry |
CA8-2744HF | Recombinant Full Length Human CA8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA8-142HCL | Recombinant Human CA8 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA8 Products
Required fields are marked with *
My Review for All CA8 Products
Required fields are marked with *
0
Inquiry Basket