Recombinant Full Length Human C8orf31 Protein, GST-tagged

• Cat.No.: C8orf31-2637HF
• Product Overview: Human C8orf31 full-length ORF (BAC04358.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C8orf31 (Chromosome 8 Open Reading Frame 31) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 40.9 kDa
• Protein length: 132 amino acids
• AA Sequence: MAEKPHQNSCNSVRQLFKTKQLVTHRDRGSCTHRAQGLLAARTTALQRSPLQQEIWESTTALNLPSALAPQGLTAKDAHFLGDTDPIQEGARDHAAGGPFQDRQASVAAQTLSWERGQGFSRHHGNHLLYSH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C8orf31 chromosome 8 open reading frame 31 [ Homo sapiens (human) ]
• Official Symbol: C8orf31
• Synonyms: C8orf31; chromosome 8 open reading frame 31; uncharacterized protein C8orf31; Chromosome 8 Open Reading Frame 31
• Gene ID: 286122
• mRNA Refseq: NM_173687
• Protein Refseq: NP_775958
• UniProt ID: Q8N9H6