Recombinant Full Length Human BLOC1S2 Protein, GST-tagged

Cat.No. : BLOC1S2-1711HF
Product Overview : Human BLOC1S2 full-length ORF ( NP_776170.2, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 142 amino acids
Description : BLOC1S2 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and DellAngelica, 2004 [PubMed 15102850]).
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 42.4 kDa
AA Sequence : MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 [ Homo sapiens ]
Official Symbol BLOC1S2
Synonyms BLOC1S2; biogenesis of lysosomal organelles complex-1, subunit 2; biogenesis of lysosome-related organelles complex 1 subunit 2; Biogenesis of Lysosome related Organelles complex 1 Subunit 2; BLOS2; centrosome protein oncogene; FLJ30135; MGC10120; BLOC-1 subunit 2; centrosomal 10 kDa protein; centrosome-associated protein; RP11-316M21.4
Gene ID 282991
mRNA Refseq NM_173809
Protein Refseq NP_776170
MIM 609768
UniProt ID Q6QNY1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BLOC1S2 Products

Required fields are marked with *

My Review for All BLOC1S2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon